PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_37275_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 170aa    MW: 19595.6 Da    PI: 9.3852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_37275_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-17148148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd++l+ +vk++G  +W+  +r  g+ R++k+c++rw++yl
  cra_locus_37275_iso_1_len_508_ver_3  1 KGKWTPEEDQKLIAYVKRYGIWNWSQMPRFAGLSRSGKSCRLRWLNYL 48
                                         79******************99************************97 PP

2Myb_DNA-binding46.21.1e-145597246
                                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         g++T eE+e +++  + lG++ W+ Ia+++  gRt++++k++w++
  cra_locus_37275_iso_1_len_508_ver_3 55 GNFTLEEEETIIRMYQNLGSR-WSVIAKELR-GRTDNEIKNFWHT 97
                                         89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.9E-11150IPR001005SANT/Myb domain
SuperFamilySSF466895.64E-29195IPR009057Homeodomain-like
PROSITE profilePS5129424.053152IPR017930Myb domain
PfamPF002492.7E-15148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-24255IPR009057Homeodomain-like
CDDcd001672.14E-10348No hitNo description
PROSITE profilePS5129414.77553103IPR017930Myb domain
SMARTSM007171.0E-1253101IPR001005SANT/Myb domain
PfamPF002493.4E-135597IPR001005SANT/Myb domain
CDDcd001679.72E-95699No hitNo description
Gene3DG3DSA:1.10.10.608.7E-2456102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
KGKWTPEEDQ KLIAYVKRYG IWNWSQMPRF AGLSRSGKSC RLRWLNYLSP DVKHGNFTLE  60
EEETIIRMYQ NLGSRWSVIA KELRGRTDNE IKNFWHTRLK KRFHNNNLVP KAQSPAVELL  120
SFQASSGSGS SSQLENSQEE IINNGSVLIY HNDGEVVSSS PESKDSTDWX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2611037108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293617.16e-57PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH45e-46MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A072TFF08e-55A0A072TFF0_MEDTR; Myb-related transcription factor
STRINGGLYMA06G45547.14e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154